PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 767aa    MW: 83586.8 Da    PI: 6.3367
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450419.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   XP_016450419.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
TIGRFAMsTIGR015577.1E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-82464IPR009057Homeodomain-like
PfamPF002493.2E-132467IPR001005SANT/Myb domain
CDDcd001671.49E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MDPYSSGEEL VVKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAVIKG VPISQALDIE IPPPRPKRKP SNPYPRKTSV AVPSSQVGIK  120
DGKLSTPFSS ICEDRNLFDL EKEPIAEKPG RNEKLGSVQE DQNKKNCSQG FTLFKEGASA  180
PSLSLGKSLQ TLAEPAGSCT LNESVPVTQG VINHDVTAKS FLTVESKEHQ KLDILDAKQS  240
FQSNSSCNTF NGGKSCQSNE KLVQDEKKDQ PSQPDHFGEF SRNDMQVPHN YPRHVPVHIL  300
DGALGVNGAQ TTPDMFYPES VSHQIGGVQG LSNLYANPTS SATSEHHSNA AMSSIHQSFP  360
CFHPNFTPIR DPDDYRSFLQ LSSTFSSLIF SALLQNPAAH AAASFAASFW PYANVEAPVD  420
CPTGNTSSQI NSAPSMAAIA AATVAAATAW WAAHGLLPLC SPFHSSSTCV PTSATSMQVD  480
PCQPSVEKNE GREGSHNSPH AQQAVPDCSE ALQEQHSASE LPTSPSSESE ESEGRKLKTG  540
LTADNTEQGA AVTEIHEPNT GKGRKQVDRS SCGSNTPSSS DLETDALEKD QKGKEEPQEP  600
NVNLLAGDAG NRRGRNCISP NDSWKEVSEG GRIAFQALFT REKLPQSFSP SNDPKNKGKI  660
NLEKIKQMPD EKGLSGSQLD LNDQASDICS SHQAVEDNVL VIGNKEDAEK CLPMMELGQV  720
RLKAHRTGFK PYKRCSLEAK DGRVASSSCQ DEEKSAKRLR LEGEASI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ4249130.0JQ424913.1 Nicotiana attenuata late elongated hypocotyl (LHY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794791.10.0PREDICTED: protein LHY
RefseqXP_016450418.10.0PREDICTED: protein LHY-like
RefseqXP_016450419.10.0PREDICTED: protein LHY-like
TrEMBLJ9PV710.0J9PV71_NICAT; Late elongated hypocotyl
STRINGSolyc10g005080.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.44e-49MYB_related family protein